PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01417.1.g00200.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 193aa    MW: 22182.5 Da    PI: 4.8206
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01417.1.g00200.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.32.4e-244594251
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    rie+   rqv fskRr+g++KKA+EL  LCda+va+i+fs+ g+lye++s
  Zpz_sc01417.1.g00200.1.sm.mkhc 45 RIEDRVSRQVRFSKRRKGLFKKAFELAELCDAQVALIVFSPAGRLYEFAS 94
                                    8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.2873696IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-303695IPR002100Transcription factor, MADS-box
CDDcd002651.09E-3438106No hitNo description
SuperFamilySSF554551.09E-2738113IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-253858IPR002100Transcription factor, MADS-box
PfamPF003192.0E-244592IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-255873IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-257394IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MDAEEARNPE LRQREEEARA GCEGDGRDEM KKAAKKKRGR VEMRRIEDRV SRQVRFSKRR  60
KGLFKKAFEL AELCDAQVAL IVFSPAGRLY EFASSNSSIE TIFDRYWNLA NTTNDLNIEV  120
RDSQNDCNMQ REQSSASSFS DHLNNIAQWV LEPNLNDLNV DELREYTADE GDWASSNSWL  180
VMKSFGSSIK EGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A6e-153896260Myocyte-specific enhancer factor 2B
1n6j_B6e-153896260Myocyte-specific enhancer factor 2B
1tqe_P5e-153896361Myocyte-specific enhancer factor 2B
1tqe_Q5e-153896361Myocyte-specific enhancer factor 2B
1tqe_R5e-153896361Myocyte-specific enhancer factor 2B
1tqe_S5e-153896361Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974004.11e-59PREDICTED: MADS-box transcription factor 56-like
RefseqXP_012702155.11e-59PREDICTED: MADS-box transcription factor 56-like
TrEMBLK3YJX13e-59K3YJX1_SETIT; Uncharacterized protein
STRINGSi014540m8e-59(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30260.14e-29AGAMOUS-like 79